PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00175.1_g00021.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 282aa    MW: 32248.6 Da    PI: 5.4229
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00175.1_g00021.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.54.3e-151461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g+WT++Ed +l + +  +G  +W+++++  g+ R++k+c++rw +yl
  Rsa1.0_00175.1_g00021.1 14 KGPWTADEDRKLMNFILTHGQCCWRAVPKLAGLLRCGKSCRLRWTNYL 61
                             79******************************99************97 PP

2Myb_DNA-binding48.71.7e-1571111547
                              -HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +  E++  +d++ qlG++ W++Ia+ ++ gRt++++k++w+++
  Rsa1.0_00175.1_g00021.1  71 SDNEEKMVIDLHSQLGNR-WSKIASNLP-GRTDNEIKNHWNTH 111
                              6779**************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.2E-21562IPR009057Homeodomain-like
PROSITE profilePS5129413.883961IPR017930Myb domain
SuperFamilySSF466891.68E-2611108IPR009057Homeodomain-like
SMARTSM007177.8E-121363IPR001005SANT/Myb domain
PfamPF002495.3E-141461IPR001005SANT/Myb domain
CDDcd001671.97E-81661No hitNo description
PROSITE profilePS5129424.91962116IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.2E-2463116IPR009057Homeodomain-like
SMARTSM007172.4E-1366114IPR001005SANT/Myb domain
PfamPF002493.8E-1371111IPR001005SANT/Myb domain
CDDcd001675.30E-1074112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 282 aa     Download sequence    Send to blast
MGRQPCCDKV GLKKGPWTAD EDRKLMNFIL THGQCCWRAV PKLAGLLRCG KSCRLRWTNY  60
LRPDLKRGLL SDNEEKMVID LHSQLGNRWS KIASNLPGRT DNEIKNHWNT HIKKKLRKMG  120
IDPLTHKPLS IVEQEEEKPL KKLQKPMEQT VEEPPNYSLT KDSNNKNMLV SYDDQLMAMN  180
LEYCVEEVPM IDPECLELIC NNSSMSSSTS TSSSSSNESS ILKDLQFPDF DWSDYGIHNN  240
NNGVGNIMEN NVMSLWDVDD FSSWDLLLND DIPQSSSTFG LF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-28121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5195651e-158AY519565.1 Arabidopsis thaliana MYB transcription factor (At1g66230) mRNA, complete cds.
GenBankBT0289041e-158BT028904.1 Arabidopsis thaliana unknown protein (At1g66230) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009105194.11e-168PREDICTED: protein ODORANT1
TrEMBLA0A078F7961e-168A0A078F796_BRANA; BnaA07g25720D protein
TrEMBLM4CIX11e-168M4CIX1_BRARP; Uncharacterized protein
STRINGBra004155.1-P1e-168(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66230.11e-119myb domain protein 20